Biotechnologie Co., Ltd. Shenzhens Haiwen ist eine Fertigung des rohen Steroid-Pulvers, der halb fertigen Öle, der fertigen Flüssigkeit, des HGH, der Peptide und der LOKALEN BETÄUBENDEN DROGEN in China.

Sales & Support
Referenzen -
Select Language
Startseite
Produkte
Über uns
Fabrik Tour
Qualitätskontrolle
Kontakt
Referenzen
English
French
German
Italian
Russian
Spanish
Portuguese
Dutch
Greek
Japanese
Korean
Arabic
Hindi
Turkish
Indonesian
Vietnamese
Thai
Bengali
Persian
Polish
StartseiteProdukte

Haar-Wachstums-Pulver

Ich habe meine Produkte empfangen, sind Sie Verpackung tun diskretes und vervollkommnen, es überraschten, die mich wirklich, bestellt .i mehr von Ihnen so bald wie möglich. Tks!

—— Robet--Australia

Ich habe mit Ihnen zu vielen Malen zusammengearbeitet, Ihre Produktqualität bin so groß, deshalb ich kaufe noch die Produkte von Ihnen. danke

—— Richard---American

Hallo ist Kamerad, Ihr bester Preis und Produkt des hohen Reinheitsgrades in meinem Land, dieses ließen mich viel Gewinn erzielen, meine Kunden sind wirklich wie es .tks so wettbewerbsfähig

—— Johnson---Canada

Ich bin online Chat Jetzt

Haar-Wachstums-Pulver

(115)
China 99,5% Haar-Wachstums-Pulver pharmazeutisches CAS 38304-91-5 hoher Reinheitsgrad Minoxidil USP34 Verteiler

99,5% Haar-Wachstums-Pulver pharmazeutisches CAS 38304-91-5 hoher Reinheitsgrad Minoxidil USP34

99,5% Haar-Wachstums-Pulver pharmazeutisches CAS 38304-91-5 hoher Reinheitsgrad Minoxidil USP34 Schnelles Detail: Sulfat Minoxidil oder Minoxidil ist eine Art von hypotonischem und verringert Blutpresse, ...    Lesen Sie weiter
2019-03-13 17:06:34
China BPH-Haar-Wachstums-Pulver Avodart/Dutasteride 164656-23-9 Duagen Verteiler

BPH-Haar-Wachstums-Pulver Avodart/Dutasteride 164656-23-9 Duagen

BPH-Haar-Wachstums-Pulver Avodart/Dutasteride 164656-23-9 Duagen Dutasteride (Avodart) Produkt Name: Dutasteride Molekulargewicht: L28.5297 InChI: nChI=1/C27H30F6N2O2 /c1-24-11-9-17-15 (4-8-21-25 (17,2) 12-10- ...    Lesen Sie weiter
2019-03-13 17:06:29
China Lyophilisiert spritzen Sie Wachstums-Steroid Sermorelin-Polypeptid des Haar-2mg/vial ein Verteiler

Lyophilisiert spritzen Sie Wachstums-Steroid Sermorelin-Polypeptid des Haar-2mg/vial ein

Lyophilisiert spritzen Sie Wachstums-Steroid Sermorelin-Polypeptid des Haar-2mg/vial ein Schnelles Detail:Produkt-Name: SermorelinSynonyme: SERMORELIN; SERMORELIN-AZETAT; YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2; TYR...    Lesen Sie weiter
2019-03-13 17:06:33
China Mund-Hongdenafil-Haar-Wachstums-Pulver weißes kristallenes CAS 98319-26-7 Verteiler

Mund-Hongdenafil-Haar-Wachstums-Pulver weißes kristallenes CAS 98319-26-7

Mund-Hongdenafil-Haar-Wachstums-Pulver weißes kristallenes CAS 98319-26-7 Schnelles Detail: Produktname Hongdenafil Anderer Name Acetildenafil CAS-Registernummer 831217-01-7 Molekulare Formel C25H34N6O3 ...    Lesen Sie weiter
2019-03-13 17:06:25
China Azetat CAS 32780-32-8 des Aphrodisiakum-Peptid-weißes Haar-Wachstums-Steroid-PT141 Verteiler

Azetat CAS 32780-32-8 des Aphrodisiakum-Peptid-weißes Haar-Wachstums-Steroid-PT141

Azetat CAS 32780-32-8 des Aphrodisiakum-Peptid-weißes Haar-Wachstums-Steroid-PT141 Schnelles Detail: Bremelanotide; PT-141 CAS Nr.: 32780-32-8 MOQ: 20Vials Reinheit (HPLC): 98.0%min. Molekulare Formel: ...    Lesen Sie weiter
2019-03-13 17:06:27
China Haar-Wachstums-Pulver Dutasteride Avodart der Gesundheits-99% Anti-Östrogen Steroide Verteiler

Haar-Wachstums-Pulver Dutasteride Avodart der Gesundheits-99% Anti-Östrogen Steroide

Haar-Wachstums-Pulver Dutasteride Avodart der Gesundheits-99% Anti-Östrogen Steroide Schnelles Detail: Produktname; Dutasteride Alias; Avodart CAS No.164656-23-9 Molekulare Formel; C27H30F6N2O2 Molekulargewicht...    Lesen Sie weiter
2019-03-13 17:06:20
China Weiße kristallene feste Anti-Östrogen Haar-Wachstums-Steroid Finasteride Proscar Steroide Verteiler

Weiße kristallene feste Anti-Östrogen Haar-Wachstums-Steroid Finasteride Proscar Steroide

Weiße kristallene feste Anti-Östrogen Haar-Wachstums-Steroid Finasteride Proscar Steroide Schnelles Detail: Produktname: Finasteride Alias: Proscar CAS: 98319-26-7 MF: C23H36N2O2 MW: 372,55 Reinheit: 99,68% ...    Lesen Sie weiter
2019-03-13 17:06:20
China 98319-26-7 Festlichkeits-Haar-Verlust Haar-Wachstums-Pulver Finasteride Propecia Verteiler

98319-26-7 Festlichkeits-Haar-Verlust Haar-Wachstums-Pulver Finasteride Propecia

98319-26-7 Festlichkeits-Haarausfall Haar-Wachstums-Pulver Finasteride Propecia Schnelles Detail: Produkt-Name Finasteride CAS-Register-Zahl 98319-26-7 Molekulare Formel C23H36N2O2 Molekulargewicht 372,5441 ...    Lesen Sie weiter
2019-03-13 17:06:02
China Starkes Kräuterauszug-Haar-Wachstums-Steroid Minoxidil CAS 38304-91-5 Verteiler

Starkes Kräuterauszug-Haar-Wachstums-Steroid Minoxidil CAS 38304-91-5

Starkes Kräuterauszug-Haar-Wachstums-Steroid Minoxidil CAS 38304-91-5 Lieb, haben SMQ solche Produkte für 12 Jahre exportiert, hochwertig mit gutem Preis und schneller Antwort, Willkommen, um mit ycsmq...    Lesen Sie weiter
2019-03-13 17:06:09
China Natürliche Haar-Wachstums-Pulver 57-85-2 Testoviron-Testosteron-Propionats-Pulver Verteiler

Natürliche Haar-Wachstums-Pulver 57-85-2 Testoviron-Testosteron-Propionats-Pulver

Natürliche Haar-Wachstums-Pulver 57-85-2 Testoviron-Testosteron-Propionats-Pulver 1. Schnelles Detail: Englischer Name: Testosteron-Propionat Englischer Name: 17beta- (Propionyloxy) androst-4-en-3-one; ...    Lesen Sie weiter
2019-03-13 17:06:15
Page 1 of 12 |< << 1  2  3  4  5  6  7  8  9  10  >> >|