Biotechnologie Co., Ltd. Shenzhens Haiwen ist eine Fertigung des rohen Steroid-Pulvers, der halb fertigen Öle, der fertigen Flüssigkeit, des HGH, der Peptide und der LOKALEN BETÄUBENDEN DROGEN in China.

Sales & Support
Referenzen -
Select Language
Startseite
Produkte
Über uns
Fabrik Tour
Qualitätskontrolle
Kontakt
Referenzen
English
French
German
Italian
Russian
Spanish
Portuguese
Dutch
Greek
Japanese
Korean
Arabic
Hindi
Turkish
Indonesian
Vietnamese
Thai
Bengali
Persian
Polish
StartseiteProdukteHaar-Wachstums-Pulver

Lyophilisiert spritzen Sie Wachstums-Steroid Sermorelin-Polypeptid des Haar-2mg/vial ein

Ich habe meine Produkte empfangen, sind Sie Verpackung tun diskretes und vervollkommnen, es überraschten, die mich wirklich, bestellt .i mehr von Ihnen so bald wie möglich. Tks!

—— Robet--Australia

Ich habe mit Ihnen zu vielen Malen zusammengearbeitet, Ihre Produktqualität bin so groß, deshalb ich kaufe noch die Produkte von Ihnen. danke

—— Richard---American

Hallo ist Kamerad, Ihr bester Preis und Produkt des hohen Reinheitsgrades in meinem Land, dieses ließen mich viel Gewinn erzielen, meine Kunden sind wirklich wie es .tks so wettbewerbsfähig

—— Johnson---Canada

Ich bin online Chat Jetzt

Lyophilisiert spritzen Sie Wachstums-Steroid Sermorelin-Polypeptid des Haar-2mg/vial ein

Lyophilisiert spritzen Sie Wachstums-Steroid Sermorelin-Polypeptid des Haar-2mg/vial ein Lieferant Lyophilisiert spritzen Sie Wachstums-Steroid Sermorelin-Polypeptid des Haar-2mg/vial ein Lieferant

Großes Bild :  Lyophilisiert spritzen Sie Wachstums-Steroid Sermorelin-Polypeptid des Haar-2mg/vial ein

Produktdetails:

Herkunftsort:China
Markenname:SMQ
Zertifizierung:USP,SGS
Modellnummer:86168-78-7

Zahlung und Versand AGB:

Min Bestellmenge:1 kg
Preis:USD 10g
Verpackung Informationen:wie Sie forderten
Lieferzeit:1-3 Tag
Zahlungsbedingungen:Western Union, Moneygram, T/T
Versorgungsmaterial-Fähigkeit:1000kg/week
Ausführliche Produkt-Beschreibung
Name: Sermorelin Formel: C149H246N44O42S
Anwendung: Peptid-Trommel Aussehen: lyophilisiertes Pulver
Skype: nicole0918 E-Mail: 2355935183@ycphar.com

Lyophilisiert spritzen Sie Wachstums-Steroid Sermorelin-Polypeptid des Haar-2mg/vial ein

 

 

Schnelles Detail:


Produkt-Name: Sermorelin
Synonyme: SERMORELIN; SERMORELIN-AZETAT; YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2; TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2; MENSCH TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2; H-TYR-ALA-ASP-ALA-ILE-PHE-THR-ASN-SER-TYR-ARG-LYS-VAL-LEU-GLY-GLN-LEU-SER-ALA-ARG-LYS-LEU-LEU-GLN-ASP-ILE-MET-SER-ARG-NH2; WACHSTUMS-HORMON-FREIGEBENDER FAKTOR (1-29), AMID, MENSCHLICH; AMID GRF (1-29) (MENSCHLICH)
CAS: 86168-78-7
MF: C149H246N44O42S
MW: 3357,88
Produkt-Kategorien: Aminosäure-Ableitungen; Peptid; Forschung Handhabung am Boden-RHObesity; Handhabung am Boden-RHPeptides für Zellbiologie; Wachstums-Hormon-freigebende Faktoren; Neuropeptides; Neurotransmission (Korpulenz); Freigebende Faktoren
Verwendung: Xanthinoxydasehemmnis

 
Verpacken u. Lieferungs-Prozess:
 
1. Lieferung: Pakete würden innerhalb 12 Stunden nach dem Empfang Ihre Zahlung vereinbart.
2. Verpacken: Steroidpulver würden diskret genug verpackt, um Gewohnheiten zu kreuzen
3. weltweit sicher. Wie Nahrung des traditionellen Chinesen verpacken, Einzelteile und andere Ausrüstungen waschend und badend, ETC….
4. Extraservice: Fotos des Pakets würden zur Verfügung gestellt, damit Sie auseinander den Steroiden sagen.
Zahl 5.Tracking würde angeboten, sobald sie freigegeben wird.
Service 6.After-sale: Alle mögliche Fragen, nachdem Sie das Paket erhielten, treten mit uns bitte zum ersten Mal in Verbindung. Probleme würden für Sie sofort gelöst.
 
Wettbewerbsvorteil:
 

  1. Reiche Erfahrung, wenn eine große Menge Behälter im chinesischen Seehafen beladen wird;
  2. Schneller Versand durch gut-angebliche Schiffslinie;
  3. Verpacken mit Paletten entsprechend dem speziellen Antrag der Käufer;
  4. Erbringen der besten Dienstleistung nach Versand durch E-Mail;
  5. Frachten zusammen mit dem Behälterverkaufsservice verfügbar;
  6. Lieferung von Fotos von Frachten vor und nach Laden in Behälter;
  7. Rohstoffe vom chinesischen Ursprung;

 

Verwandte Produkte:

 

Polypeptid-Reihe

 Produkt-Name

Spezifikation

MGF

2mg/vial

KLAMMER-MGF

2mg/vial

CJC-1295 mit DAC

2mg/vial

CJC-1295 ohne DAC

2mg/vial

PT-141

10mg/vial

MT-1

10mg/vial

MT-2

10mg/vial

GHRP-2

10mg/vial

GHRP-2

5mg/vial

GHRP-6

10mg/vial

GHRP-6

5mg/vial

Ipamorelin

2mg/vial

Hexarelin

2mg/vial

Sermorelin

2mg/vial

Oxytocin

2mg/vial

 TB500

2mg/vial

pentadecapeptide BPC 157

2mg/vial

HGH 176-191

2mg/vial

Triptorelin2mg/vial
Tesamorelin2mg/vial
Gonadorelin2mg/vial
Gonadorelin10mg/vial
DSIP2mg/vial
Selank5mg/vial

 

 

 
 
Lyophilisiert spritzen Sie Wachstums-Steroid Sermorelin-Polypeptid des Haar-2mg/vial ein

Kontaktdaten
Shenzhen Haiwen Biotechnology Co.,Ltd

Ansprechpartner: Mrs. Lisa

Senden Sie Ihre Anfrage direkt an uns (0 / 3000)

Andere Produkte

99,5% Haar-Wachstums-Pulver pharmazeutisches CAS 38304-91-5 hoher Reinheitsgrad Minoxidil USP34

BPH-Haar-Wachstums-Pulver Avodart/Dutasteride 164656-23-9 Duagen

Lyophilisiert spritzen Sie Wachstums-Steroid Sermorelin-Polypeptid des Haar-2mg/vial ein

Mund-Hongdenafil-Haar-Wachstums-Pulver weißes kristallenes CAS 98319-26-7

Azetat CAS 32780-32-8 des Aphrodisiakum-Peptid-weißes Haar-Wachstums-Steroid-PT141

Haar-Wachstums-Pulver Dutasteride Avodart der Gesundheits-99% Anti-Östrogen Steroide

Weiße kristallene feste Anti-Östrogen Haar-Wachstums-Steroid Finasteride Proscar Steroide