Biotechnologie Co., Ltd. Shenzhens Haiwen ist eine Fertigung des rohen Steroid-Pulvers, der halb fertigen Öle, der fertigen Flüssigkeit, des HGH, der Peptide und der LOKALEN BETÄUBENDEN DROGEN in China.

Sales & Support
Referenzen -
Select Language
Startseite
Produkte
Über uns
Fabrik Tour
Qualitätskontrolle
Kontakt
Referenzen
English
French
German
Italian
Russian
Spanish
Portuguese
Dutch
Greek
Japanese
Korean
Arabic
Hindi
Turkish
Indonesian
Vietnamese
Thai
Bengali
Persian
Polish
StartseiteProdukte

steroids for hair growth

Ich habe meine Produkte empfangen, sind Sie Verpackung tun diskretes und vervollkommnen, es überraschten, die mich wirklich, bestellt .i mehr von Ihnen so bald wie möglich. Tks!

—— Robet--Australia

Ich habe mit Ihnen zu vielen Malen zusammengearbeitet, Ihre Produktqualität bin so groß, deshalb ich kaufe noch die Produkte von Ihnen. danke

—— Richard---American

Hallo ist Kamerad, Ihr bester Preis und Produkt des hohen Reinheitsgrades in meinem Land, dieses ließen mich viel Gewinn erzielen, meine Kunden sind wirklich wie es .tks so wettbewerbsfähig

—— Johnson---Canada

Ich bin online Chat Jetzt

steroids for hair growth

(228)

Haar-Wachstums-Pulver 38304-91-5 Haar-Verlust-Behandlungs-Droge Minoxidil 99% minimales

Haar-Wachstums-Pulver 38304-91-5 Haarausfall-Behandlungs-Droge Minoxidil 99% minimales 1. Grundlegende Beschreibung: Minoxidil ist eine antihypertensive gefäßerweiternde Medikation. Es auch verlangsamt oder ...Lesen Sie weiter
2019-03-13 17:06:04

Weiße kristallene feste Anti-Östrogen Haar-Wachstums-Steroid Finasteride Proscar Steroide

Weiße kristallene feste Anti-Östrogen Haar-Wachstums-Steroid Finasteride Proscar Steroide Schnelles Detail: Produktname: Finasteride Alias: Proscar CAS: 98319-26-7 MF: C23H36N2O2 MW: 372,55 Reinheit: 99,68% ...Lesen Sie weiter
2019-03-13 17:06:20

Testosteron Enanthate-Haar-Wachstums-Pulver-Hormon bodybuildendes 315-37-7

Testosteron Enanthate-Haar-Wachstums-Pulver-Hormon bodybuildendes 315-37-7 1. Schnelles Detail: Produktname Testosteron Enanthate-Fabrik-Lieferung Anderer Name Testosteron enantate; Testosteron enthanoate; ...Lesen Sie weiter
2019-03-13 17:06:15

Haar-Wachstums-Pulver CAS 38304-91-5 Haar-Verlust-Behandlungs-Droge Minoxidil-Reinheits-99% minimales

Haar-Wachstums-Pulver 38304-91-5 Haarausfall-Behandlungs-Droge Minoxidil 99% minimales 1. Grundlegende Beschreibung: Minoxidil ist eine antihypertensive gefäßerweiternde Medikation. Es auch verlangsamt oder ...Lesen Sie weiter
2019-03-13 17:06:13

Betäubendes Haar-Wachstums-Pulver Proscar-Schmerzmittel 98319-26-7 Finasteride, Prostide

Haar-Wachstums-Pulver mischt sicheres lokales Betäubungsmittel Proscar beruhigendes CAS 98319-26-7 Finasteride, Prostide Drogen bei 1. Schnelles Detail: Produktname Formestane-Fabrik-Lieferung Anderer Name ...Lesen Sie weiter
2019-03-13 17:06:14

Dutasteride-Haar-Wachstums-Steroid-Hormon-Pulver Avodart für Haar-Verlust-Behandlung

Selbsteinleitung: Unsere Firma haben diese Linie für mehr als 10 Jahre, wir werden erfahren mit dem speziellen Produkt, sicheres Verschiffen getan und hoher Erfolg für die überschreitenen Gewohnheiten, begrüßen ...Lesen Sie weiter
2019-03-13 17:06:06

Dutasteride Avodart Grad 164656-23-9 des Haar-Wachstums-Steroid-99% Pharma

Dutasteride Avodart Grad 164656-23-9 des Haar-Wachstums-Steroid-99% Pharma Grundlegende Beschreibung: Dutasteride (Avodart), hergestellt durch GlaxoSmithKline, ist ein Doppel5 α Reduktasehemmnis, das Umwandlung ...Lesen Sie weiter
2019-03-13 17:06:13

Vergrößerte Prostatabehandlungs-Haar-Wachstums-Steroid 164656-23-9 Duagen

Vergrößerte Prostatabehandlungs-Haar-Wachstums-Steroid 164656-23-9 Duagen 1. Schnelles Detail: Dutasteride Alias: Avodart; Duagen KEIN CAS: 164656-23-9 MF: C27H30F6N2O2 MW: 528,53 Reinheit: 99% Auftritt: weißes ...Lesen Sie weiter
2019-03-13 17:06:15

Finasteride-Haar-Wachstums-Steroid-Hormon-Pulver Proscar/Propecia

Selbsteinleitung: Unsere Firma haben diese Linie für mehr als 10 Jahre, wir werden erfahren mit dem speziellen Produkt, sicheres Verschiffen getan und hoher Erfolg für die überschreitenen Gewohnheiten, begrüßen ...Lesen Sie weiter
2019-03-13 17:06:06

Lyophilisiert spritzen Sie Wachstums-Steroid Sermorelin-Polypeptid des Haar-2mg/vial ein

Lyophilisiert spritzen Sie Wachstums-Steroid Sermorelin-Polypeptid des Haar-2mg/vial ein Schnelles Detail:Produkt-Name: SermorelinSynonyme: SERMORELIN; SERMORELIN-AZETAT; YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2; TYR...Lesen Sie weiter
2019-03-13 17:06:33
Page 1 of 10 |< << 1  2  3  4  5  6  7  8  9  10  >> >|